Lade Inhalt...

Eine ganzheitliche Betrachtung des Phänomens "Farbe". Anwendung in der Architekturgestaltung von Bildungseinrichtungen am Beispiel von Bruno und Max Taut

Examensarbeit 2005 130 Seiten

Pädagogik - Wissenschaft, Theorie, Anthropologie

Leseprobe

Inhaltsverzeichnis

1. Problemstellung, Anspruch und Forschungs- bzw. Literaturlage

2. Phänomenologie der Farbwahrnehmung–zwischen Naturwissenschaft, Geisteswissenschaft und Metaphysik
2.1 Ganzheitlichkeit – eine Begriffsklärung
2.2 Farbe, Licht und Sehen in der Naturwissenschaft
2.2.1 Erkenntnisse aus der Physik
2.2.2 Erkenntnisse aus der Chemie
2.2.3 Erkenntnisse aus Neurobiologie, Physiologie und Genetik des Menschen
2.2.4 Exkurs: Visuelle Phänomene
2.2.5 Die Grenzen der Naturwissenschaft
2.3 Farbe, Licht und Sehen in der Geisteswissenschaft
2.3.1 Kulturhistorische und philosophische Ansätze
2.3.2 Psychologie und Symbolwirkung der Farbe
2.3.3 Die Farbe in der Architektur
2.3.4 Die Farbe in Schulbau und Erziehungswissenschaft
2.3.5 Die Grenzen der Geisteswissenschaft
2.4 Farbe, Licht und Sehen in der Metaphysik
2.4.1 Religiöse und kosmologische Ansätze
2.4.2 Licht- bzw. Farbtherapie und Aura-Chakra-Lehre
2.4.3 Der Theosophisch-anthroposophische Ansatz

3. Die Farbe im Welt- und Menschenbild von Bruno und Max Taut
3.1 Biografische und zeitgeschichtliche Einordnung
3.2 Weltanschauliche Positionen
3.3 Die Funktionen der Farbe

4. System oder Willkür? Farbuntersuchungen an Schulbauten von Bruno und Max Taut
4.1 Die Auswahl der zu untersuchenden Schulbauten
4.2 Der Versuchspavillon der Gemeinschaftsschule Berlin-Neukölln
4.3 Das Dorotheen-Lyzeum Berlin-Köpenick
4.4 Die Schulgruppe Berlin-Lichtenberg
4.5 Die Katholische Volksschule Senftenberg

5. Zusammenfassung

6. Quellen- und Literaturverzeichnis

7. Anhang

1. Problemstellung, Anspruch und Forschungs- bzw. Literaturlage

Es gibt wenige Themen, die den Menschen so unmittelbar berühren wie das des Farbensehens. Gerade Farbimpulse ermöglichen dem Normalsichtigen neben den Empfindungen der Sinne vor allem auch eine differenzierte Wahrnehmung der Welt. Dabei ist erstaunlich, wie wenig dies tatsächlich als Phänomen wahrgenommen wird. Die Geschichte der Beschäftigung mit den Wesenszügen von Licht, Farbe und Sehen macht deutlich, wie schwer es offenbar fällt, die Mauer der Selbstverständlichkeit zu durchbrechen und sich zum Zwecke der Auseinandersetzung mit eigenen Wahrnehmungen sozusagen auf die Meta-Ebene zu begeben. In der Tat macht erst die eingehende Betrachtung deutlich, wie unnahbar Farben sind und wie überschaubar gering die Zahl allgemeingültiger Aussagen über deren Wahrnehmung ist. Anders als z. B. bei Körpern ist Existenz und Dimensionalität einer Farbe nicht absolut, nicht physikalisch-kausal geschlossen, sondern wird von vielen noch zu untersuchenden Faktoren beeinflusst: Das Empfinden von Farbigkeit ist letztlich ein Konstrukt des Gehirns und damit im höchsten Maße individuell und subjektiv. Legt man hier zusätzlich die Frage nach der harmonischen Wirkung zugrunde, reduziert sich das Maß der Allgemeingültigkeiten auf ein Minimum. Relativität der subjektiven Empfindungen und immense naturwissenschaftliche Komplexität der menschlichen Physe und Psyche verzögern oder verhindern gar das Erlangen von – im Sinne der Wissenschaft – verlässlichen Erkenntnissen.

Wenn auch nicht in jedem Falle nachvollziehbar, so bleiben die Effekte, die Licht und Farbe auf den menschlichen Organismus, die Psyche und psychosomatische Zusammenhänge haben, dennoch beobacht- und damit unbestreitbar. Das Erleben von Farbigkeit und ihrer unmittelbaren Wirkung ist sinnlichen, atmosphärischen Charakters, geht über das rational Fass- und Verstehbare hinaus und kann sogar übersinnlich erscheinen. So nimmt es denn nicht Wunder, wenn die Lücken, die die Naturwissenschaft in ihren Erklärungsmustern für das Wesen von Licht und Farben zwangsläufig hinterlässt, mit geisteswissenschaftlichen und vorwissenschaftlich-metaphysischen Ansätzen aufgefüllt werden und – geht man von der Existenz menschlichen Seelen- und Geistes lebens aus1 – wohl auch werden müssen. Hier wird deutlich, wie eng die Frage nach dem Licht und seinen Farben mit dem jeweiligen Welt- und Menschenbild verbunden ist.

Ein Versuch, sich dem Phänomen Farbe anzunähern, kann demnach nur in Teilen dem Anspruch einer unbedingten Wissenschaftlichkeit genügen. Aufgabe dieser Arbeit wird es sein, wissenschaftliche Erkenntnisse zu sondieren und als solche zu kennzeichnen, ohne aber gleichzeitig alle metaphysischen Erklärungsmuster kategorisch zu negieren: Auf etliche Fragen lassen sich Positionierungen maximal vergleichend gegenüberstellen, mitnichten jedoch endgültig klären. Eine Auswahl entsprechender Ansätze soll ebenfalls in groben Zügen dargestellt werden. Somit ist nicht nur die frappierende Bandbreite der zu untersuchenden Themen herausfordernd, sondern auch die jedem Stoffgebiet individuell anzupassende methodische Annäherungsweise, welche zwangsläufig zwischen Natur- und Geisteswissenschaft, zwischen normativ-ontologischen, empirisch-analytischen und dialektisch-historischen Theorieansätzen2, ja sogar exegetischen Überlegungen changiert.

Dementsprechend kann und will die vorliegende Untersuchung keinen Anspruch auf Vollständigkeit erheben. Allein der nur begrenzt zur Verfügung stehende Raum – sowohl zeitlich als auch in Bezug auf den Umfang – beschränkt sie auf die Form eines Annäherungsversuches.

Der Gegenstand dieser Arbeit stellt eine bisher offenbar noch nicht in ihrer Gänze untersuchte Schnittstellenproblematik dar: Es gibt in der Literatur zweifelsohne zahlreiche wissenschaftliche Äußerungen zu den einzelnen Entitäten des Phänomens 'Farbensehen', die es wenigstens exemplarisch zur Kenntnis zu nehmen gilt. Die Verbindung all dieser Erkenntnisse jedoch ist ein selten anzutreffendes Publikationsfeld – meist sind fachübergreifende Betrachtungen auf Nebensätze beschränkt. Der trennende Graben zwischen Naturwissenschaft, Geisteswissenschaft und mehr noch der Metaphysik scheint tief, seine Überschreitung gleichsam mit dem Verdacht der Illoyalität behaftet zu sein. Ein ganzheitlicher Ansatz ist von dieser Warte aus eine Gratwanderung. Dennoch ist es erst dieser Schritt, der klarmacht, welchen Stellenwert die Farbe tatsächlich innehat. Folglich wird eine solchartigen Überlegungen verpflichtete Phänomenologie der Farbwahrnehmung am Anfang stehen müssen. Sie soll – im möglichen Rahmen – eine Übersicht über den aktuellen Erkenntnisstand der Naturwissenschaft geben, die geisteswissenschaftlichen Überlegungen hinzuziehen und letztendlich auch die darüber hinausgehenden Mystizismen anschneiden: Sind es doch hauptsächlich die metaphysisch verstandenen Wesenszüge von Farbe und Licht, die konkreten Einfluss auf das Weltbild und damit auf Handlungsweise von Menschen haben können.

Nach der allgemeinen Betrachtung stellt sich die Frage, welche unmittelbaren Auswirkungen das Phänomen „Farbe“ auf das individuelle Welt- und Menschenbild haben kann. In diesem Sinne soll im zweiten größeren Komplex dieser Arbeit der Fokus auf das Leben und das Œuvre der Architektenbrüder Bruno (1880-1938) und Max (1884-1967) Taut gelegt werden. Als Förderer und Mitinitiatoren der Farbenbewegung der 20er Jahre haben sie großen Einfluss auf die Geschichte der Architektur und das Verständnis des farbigen Bauens erlangt. Da die Gestaltung von Schulbauten einen großen Raum im Leben beider eingenommen hat und menschenbildliche Vorstellungen besonders anschaulich dort zum Ausdruck kommen, wo sich Ansichten zur Erziehung von Menschen äußern, soll die Funktion der Farbe speziell im Tautschen Schulbau untersucht werden.

Auch hier handelt es sich offenbar um eine Schnittstellenproblematik: Bisher wurde in der Taut-Forschung bedauerlicherweise strikt zwischen beiden Brüdern getrennt. Grund dafür könnte das ambivalente Verhältnis der beiden Architekten zueinander, die Pragmatik Max Tauts bzw. die Dominanz und Öffentlichkeitswirksamkeit Brunos sein. Letztere evoziert einerseits die unterschiedlich starke Faszinations- und Polarisationswirkung: Über Bruno Taut sind ungleich mehr Publikationen verfasst worden, viele davon in eher huldigendem Habitus. Andererseits aber ist es gerade der weniger mitteilungsfreudige Max Taut, von dessen Schulentwürfen tatsächlich einige gebaut wurden und überwiegend gut erhalten sind. Für das Thema dieser Arbeit stellt sich hier ein Problem dar: Die heute auf ihre ursprüngliche Farbigkeit untersuchbaren Schulbauten gehen überwiegend auf Max Taut zurück, während die theoretischen Äußerungen über die Farbe hauptsächlich aus der Feder Bruno Tauts stammen. Weiterhin stellt die (Innen-)Farbigkeit der Tautschen Schulbauten an sich eine Frage dar, die aufgrund bisher fehlender und teilweise erst kürzlich erstellter restauratorischer Farbgutachten noch nicht weitgehend erforscht werden konnte. Die vorliegende Betrachtung kann sich in diesem Punkt also nicht auf bereits vorhandene Literatur stützen, sondern ist auf eigene Recherchen und Interpretationen angewiesen.

Insgesamt kann festgehalten werden, dass die Themenstellung bereits Herausfor- derungen methodischer und umfänglicher Art in sich trägt, denen es in für diese Arbeit angemessener Form zu begegnen gilt. Um so deutlicher wird, dass jeder Anspruch, der höher griffe als der einer Annäherung, in hohem Maße unrealistisch wäre.

2. Phänomenologie der Farbwahrnehmung–zwischen Naturwissenschaft, Geisteswissenschaft und Metaphysik

2.1 Ganzheitlichkeit – eine Begriffsklärung

Neuzeitliche Wissenschaft gewinnt ihre Erkenntnisse nach dem Prinzip der Arbeits teilung. Angesichts der immer zahlreicher werdenden und gleichzeitig enger gefassten Spezialisierungen ist dies auch durchaus angemessen und überaus erfolgreich. Wie jedoch Karl Müller-Reissmann treffend bemerkt, geschieht die notwendige Zusammenfassung der so gewonnenen Einzelerkenntnisse vorwiegend nicht auf der Wissensebene, sondern auf der Ebene neu entwickelter Technologien: „Das bedeutet Eingriff in die unendlich komplexe lebendige Wirkungsganzheit, meist ohne dass durch die Erkenntnisse der Wissenschaft die Wirkungsganzheit auch nur ein bisschen besser verstanden wird.“3 Das Verständnis des Wesens einer Sache ist offenbar für die Wissenschaft weniger interessant als die wirtschaftlich-technologische – und gewinnbringend verkäufliche – Verwertung derselben. Ohne die Zusammenführung der einzelnen Entitäten zu einem Ganzen bleibt jedoch vieles unberücksichtigt und möglicherweise ungenutzt. Die gegenwärtig beobachtbare Renaissance kultischer, esoterischer sowie magischer Denkformen und Lebenshaltungen mag man als Reaktion darauf verstehen. Müller-Reissmann spricht von dem Versuch des »Bauches«, dem »Kopf« die Vorherrschaft streitig zu machen.4 Sowohl Wissenschaftler als auch Mystiker erheben bisweilen Absolutheitsansprüche auf die 'Wahrheit'. Dabei wird oft vergessen, dass die heutige wissenschaftliche Grundlage ihrer Entstehung nach ein Produkt aus beidem ist – aus Gefühl (Ahnung, Spiritualität) und aus Verstand (Beobachtung, Analyse). Die strikte Trennung von Philosophie und Physik ist eine Erfindung der Neuzeit (vgl. 2.3.1).

Wenn in dieser Arbeit das Wesen der Farbe betrachtet werden soll, dann in einer Form, die eine gewisse 'Ganzheitlichkeit' anstrebt. Der Begriff der 'Ganzheitlichkeit' ist aufgrund seines inflationären Gebrauchs etwas verfänglich und muss an dieser Stelle geklärt werden. Er wird in einer bemerkenswerten Dissertation von Gabriele Stier ausgiebig diskutiert. Die Terminologie in der hier vorliegenden Betrachtung kann im Sinne von Stiers 'moderner Naturphilosophie' verstanden werden. In dieser Kategorie fasst die Autorin – in Nachfolge von Bartels und Kanitschneider – Ansätze zusammen, deren paradigmatische Grundlage so geartet ist, dass „Deutungen auf Erkenntnissen der neuen Naturwissenschaften basieren und sie bei ihren interpretierenden Erweiterungen versuchen, nicht in Widerspruch zu diesen Theorien zu kommen.“5 Auch wenn im Folgenden sehr unterschiedliche philosophische und metaphysische Ansätze Beachtung finden werden, so soll dies jedoch auf einer rein rezeptiven, vergleichenden bzw. ideengeschichtlich exegetischen Ebene geschehen: Kosmologische Fragen werden nur im Rahmen individueller Weltbilder eine Rolle spielen.

Die Ganzheitlichkeit ist weiterhin als Instrument zu verstehen, welches über wissenschaftliche Bereichsgrenzen hinweg ein möglichst breites Entitätenspektrum des Phänomens „Farbe“ zusammentragen will. Um diesem Anspruch gerecht zu werden, teilt sich die nun folgende Phänomenologie der Farbwahrnehmung in drei Unterbereiche auf, von denen je einer der Naturwissenschaft, der Geisteswissenschaft und der Metaphysik gewidmet ist.

2.2 Farbe, Licht und Sehen in der Naturwissenschaft

2.2.1 Erkenntnisse aus der Physik

Die Beschäftigung der Physik mit diesem Themenkomplex beschränkt sich hauptsächlich auf das Ergründen der Natur des Lichtes6, weniger auf den Sehvorgang und die Farb empfindung. In der Antike und im Mittelalter können zwar durchaus verschiedene Erklärungs- oder Systematisierungsansätze für Licht und Farben konstatiert werden, diese sind jedoch eher Beschreibungen und Überlegungen philosophischen Charakters (vgl. 2.3.1). Die naturwissenschaftliche, namentlich physikalische Auseinandersetzung damit setzt erst in der Neuzeit ein.

Nachdem Johannes Kepler (1571-1630) noch eine rein geometrische Optik vertrat, begann sich bereits Mitte des 17. Jahrhunderts die Vorstellung durchzusetzen, dass sich das Licht in Wellenform ausbreitet. Damit konnten Erscheinungen wie Brechung, Beugung und Interferenz erklärt werden. Als Wegbereiter der Wellentheorie des Lichts sind neben Christian Huygens (1629-1695) und Robert Hooke (1635-1703) auch Francesco Maria Grimaldi (1618-1663) oder Johannes Marcus Marci de Kronland (1595-1667) zu nennen. Eine andere Hypothese, die Teilchentheorie, tritt 1672 mit Isaac Newton s (1643-1727) Abhandlung »Neue Theorie über Licht und Farben« ins Blickfeld. In seiner Schrift beschreibt er die Beobachtungen aus seinen bekannten Versuchen, in denen ihm mithilfe eines Prismas die spektrale Zerlegung des Sonnenlichts gelang. Seine Überlegungen führten ihn zu dem Schluss, dass das Licht aus unterschiedlich großen Teilchen (Korpuskeln) bestehen müsse, die beim Durchgang durch das Prisma der Geschwindigkeitsänderung wegen unterschiedlich stark abgelenkt, also spektral zerlegt werden. Das weiße Tageslicht ist nach Newton ein Gemisch sämtlicher Korpuskelgrößen und beinhaltet damit sämtliche Farben.7 So sind die Farben nicht mehr Eigenschaften, sondern vielmehr Erscheinungsformen des Lichtes. Aus dem prismatischen Farbband entwickelte Newton um einen weißen Mittelpunkt herum den ersten Farben kreis und löste damit das lineare Farbordnungsmodell ab.8

In diesen Modellen standen sich zwei als miteinander unvereinbar verstandene Hypothesen zur Natur des Lichtes gegenüber. Ein langwieriger Streit entbrannte. Viele Physiker versuchten, jeweils Argumente für die eine und gegen die andere Vorstellung zu finden. Erst Anfang des 19. Jahrhunderts stellte sich das Interferenzprinzip eines Thomas Young (1773-1829) als entscheidendes Argument für die Wellentheorie heraus. Nebenbei gelang es dem Engländer erstmalig, nicht nur zu postulieren, dass „die Wellenlänge für das Licht verschiedener Farben verschieden ist“9, sondern auch die Größenordnung abzuschätzen, die im Spektrum des Sonnenlichts eine Rolle spielen. Als kurze Zeit später Newtons Herleitung des Brechungsgesetzes widerlegt werden konnte, wurde die Teilchenvorstellung für lange Zeit verworfen.

Die zweite Hälfte des 19. Jahrhunderts brachte zum Vorschein, dass Licht mit Elektrizität in Zusammenhang steht und mit 360 nm bis 760 nm Wellenlänge nur ein kleiner Ausschnitt aus dem Spektrum der elektromagnetischen Wellen ist. Elektromagnetische Wellen erwiesen sich als selbstständige physikalische Realitäten, bei denen sich elektrische und magnetische Wechselfelder mit Lichtgeschwindigkeit10 ausbreiten: Der Vektor der elektrischen Feldstärke ist für die Lichtwirkung verantwortlich (Lichtvektor) und schwingt senkrecht zur Ausbreitungsrichtung des Lichtes. Der Vektor der magnetischen Feldstärke schwingt senkrecht und in der Phase verschoben zu jenem Lichtvektor und ebenfalls senkrecht zur Ausbreitungsrichtung, hat jedoch in optischer Hinsicht keine Bedeutung. Die Vorstellung eines elastischen Lichtäthers wurde damit überflüssig. Namen wie James Clerk Maxwell (1831-1879), Michael Faraday (1791-1867), John Kerr (1824-1907) und Heinrich Hertz (1857-1894) sind in diesem Zusammenhang zu nennen.

Aus dieser Erkenntnis heraus soll hier kurz einiges heute Bekannte über die 'Ausschnitthaftigkeit' des natürlichen Tageslichts an der Erdoberfläche eingeschoben werden. Es handelt sich in diesem Fall um einen Ausschnitt aller von der Sonne emittierten elektromagnetischen Wellen. Die Erdatmosphäre (und darin speziell das Ozon und der Wasserdampf) absorbiert und reflektiert verschiedene Wellenbereiche der Sonnenstrahlung unterschiedlich stark – ohne diese abschirmende Wirkung wäre ein Leben auf der Erde nicht möglich. Das dennoch in hoher Intensität bis zur Erdoberfläche durchdringende Spektrum der optisch wahrnehmbaren Wellenlängen, des Lichtes also, wird auch als 'optisches Fenster' bezeichnet (siehe Abb. 1). Ihm entspricht in etwa die durchschnittliche Empfindlichkeit des menschlichen Auges (siehe Abb. 2).

Abbildung in dieser Leseprobe nicht enthalten

Abb.1: Verteilung der Intensität, die das Sonnen- licht für verschiedene Wellenlängen aufweist

Quelle: Fischer (1994), S. 27

Abbildung in dieser Leseprobe nicht enthalten

Abb. 2: Empfindlichkeiten des menschlichen Auges für den Bereich des sichtbaren Spektrums

Um 1900 entwickelte Max Planck (1858-1947) seine Quantentheorie, für die er 1918 den Nobelpreis erhielt. Die Theorie besagt, dass die Energie elektromagnetischer Strahlung in kleinsten Teilchen (Energiequanten) emittiert und absorbiert wird, deren Energieniveau proportional abhängig von der Frequenz ist. Dieses Konzept widersprach der ganzen bisherigen Physiktheorie. Albert Einstein (1879-1955) ergänzte, dass elektromagnetische Strahlung selbst eine Form von Quantenbewegung ist. 1921 bekam er den Nobelpreis für die »quantenmäßige Deutung des lichtelektrischen Effekts«. Einstein konstatierte: Je heller Licht ist, desto mehr Photonen (Energiequanten) sind in seiner Strahlung enthalten. Je höher die Frequenz des Lichtes ist, desto mehr Energie besitzen die Photonen11 und können derart auf eine elektrisch geladene Metallplatte wirken, dass sie Elektronen aus ihr 'herausschlagen' und diese entladen können. Bis zur Entdeckung des lichtelektrischen Effekts hatten die Anhänger der Wellentheorie die Oberhand. Einsteins Überlegungen zeigten aber, dass dieser Effekt nicht mit der Wellenvorstellung vereinbar, sondern erneut nur mit einer Teilchenvorstellung zu erklären ist.

Heute steht fest, dass man bezüglich des Lichts von einem Dualismus von Welle und Teilchen (Korpuskel) ausgehen muss. Das bedeutet, dass das gleiche atomare Gebilde sich je nach der Versuchsanordnung oder Beobachtungsart einmal wie ein Korpuskel, d. h. wie ein Punktteilchen, und das andere Mal wie ein ausgedehntes Wellenfeld verhält. Beides sind gleichwertige Zustände eines Quants und so müssen beide Modelle, wenn auch niemals gleichzeitig, so doch nebeneinander herangezogen werden. Dieses Phänomen trifft offenbar nicht nur auf elektromagnetische Wellen zu, sondern auch auf Materiestrahlung von Elektronen, Protonen, Alphateilchen oder Atomen. Der Welle-Teilchen-Dualismus stellt als quantenmechanisches Konzept eine der wichtigsten Erkenntnisse der neueren Physik dar und konnte im Rahmen der Quantenelektrodynamik (QED) erforscht werden. Diese beschäftigt sich mit der Wechselwirkung von Licht und Materie und ist die erste Quantenfeldtheorie, die die Schwierigkeiten einer konsistenten quantentheoretischen Beschreibung von Feldern und die Erzeugung (Emission) bzw. Auslöschung (Absorption) von Teilchen befriedigend löst. Sie zählt zu den genauesten aller physikalischen Theorien und bietet die Basis, auf der sich die eigentlich gegensätzlichen Theorien mathematisch harmonisieren lassen. Die QED wurde in den 1940er Jahren entwickelt und 1965 mit der Verleihung des Nobelpreises für Physik an Richard P. Feynman (1918-1988), Julian Schwinger (1918-1994) und Shinichiro Tomonaga (1906-1979) gewürdigt.

Die neben Reflexion, Brechung, Interferenz, Beugung und Ablenkung heutzutage bekannten Vorgänge bei der Wechselwirkung von Licht und Materie im Detail zu beschreiben, würde den Umfang dieser Arbeit sprengen. Im Hinblick auf die später zu diskutierenden Fragen – denn das Sehen beruht auf solchen Wechselwirkungen – soll allerdings an dieser Stelle wenigstens eine grobe Vorstellung vermittelt werden. Grundlage dieser Betrachtungen ist das Atommodell von Niels Bohr (1885-1962).

a) Absorption: Prallt ein Photon mit einem Elektron zusammen, absorbiert Letzteres diesen Strahlungsquant mit seiner spezifischen Energie und gelangt dadurch auf ein höheres Energieniveau – es entfernt sich um einen bestimmten Betrag vom Atomkern.
b) Emission: Fällt das Elektron wieder auf sein vorheriges Niveau ab, emittiert es ein Strahlungsquant, ein Photon mit einer charakteristischen Wellenlänge (das emittierte Photon ist ein klein wenig energieärmer als das absorbierte, weil das Elektron diesen Differenzbetrag für die Bewegung zwischen den Energieniveaus benötigt.)
c) Strahlungsdruck: Neben seiner Energie überträgt ein Photon auch seinen Impuls auf das Materieteilchen, es wird also ein gewisser Strahlungsdruck ausgeübt, d. h. eine pro Flächeneinheit ausgeübte Kraft, die umso größer ist, je mehr Quanten auf die betrachtete Fläche treffen und je größer deren Impuls ist. Der obig beschriebene und von Einstein erklärte 'lichtelektrische Effekt' beruht genau auf diesem Phänomen. Ergo: Der durch Strahlung hervorgerufene Druck auf die Materie kann so groß werden, dass er Veränderungen auf atomarer bzw. molekularer Ebene nach sich zieht. Dies setzt jedoch entweder hohe Wellenfrequenzen (bzw. geringe Wellenlängen), hohe Strahlungsintensität oder geringe Bindungsstabilität in der Molekularstruktur der Materie voraus.

Festzuhalten bleibt, dass die Lichtstrahlung in jedem Fall eine wenn auch noch so gering dimensionierte Wechselwirkung mit der sich ihr bietenden Materie eingeht. Auch der menschliche Körper wird als Materie in seiner Gesamtheit mit der jeweiligen Strahlung konfrontiert. Nicht nur die Augen, sondern sämtliche Oberflächen (Haut, Haare etc.) treten mit ihr in Wechselwirkung.12 Jedoch sind es die Augen und der gesamte Sehapparat, die als spezialisierte Sinnesorgane aus der Absorption der Lichtquanten sinnvolle und verarbeitbare Informationen produzieren können.

Physikalisch betrachtet ist die Farbe nicht real existent. Die einzigen in der Lichtstrahlung optisch wirksamen Elemente sind die Lichtquanten (Photonen) – und diese sind farbneutral. Sie haben jedoch in Abhängigkeit von der jeweiligen Wellenfrequenz ein unterschiedlich hohes Energieniveau und einen damit verbundenen Impuls, mit dem sie auf Materie auftreffen. Das menschliche Auge ist lediglich in der Lage, in flächendifferenzierter Form aus den verschieden stark und frequent 'einschlagenden' Photonen elektronische Nervenimpulse zu produzieren, also Wellenfrequenz- und Leuchtdichteunterschiede sowie auch Spektrumszusammensetzungen abzubilden und ans Gehirn weiterzugeben. Was der Mensch aber letztlich als Farb eindruck erfährt, ist ein Verarbeitungsprodukt des Gehirns und differiert teilweise in erheblichem Maße von den tatsächlich physikalisch messbaren Wellenlängen und -intensitäten. Im späteren Verlauf näher zu erläuternde Phänomene wie die Farbkonstanz und Kontrasteffekte (z. B. Komplementärverschiebung, Simultankontrast, Sukzessivkontrast) zeigen, dass die (Farb-)Wahrnehmung – zumindest beim Menschen – weniger physikalisch als Sehvorgang, sondern vielmehr neurobiologisch als Konstrukt nicht- selektiver Seheindrücke und vorheriger Seherfahrungen zu verstehen ist. Farbigkeit ist demnach keine intrinsische und damit absolute Eigenschaft, sondern ein vom Gehirn zuge- wiesenes Attribut – mit allen so möglichen Wahrnehmungsverzerrungen und -verschiebungen (vgl. 2.2.4).

Der hier geschlagene direkte Bogen vom Licht zur Farbe mag auf den ersten Blick erstaunen. Ist denn ein farbiger Körper bei Dunkelheit nicht mehr farbig? Diese Frage an sich geht bereits von einem fehlerhaften Ansatz aus. In Wirklichkeit existieren keine 'farbigen' Körper, sondern lediglich Körper, deren Oberflächen das vorhandene Licht unterschiedlich reflektieren bzw. absorbieren. Dabei hängt es von den (Material-) Eigenschaften der Oberfläche ab, welche spektralen Anteile des Lichtes wie stark absorbiert oder reflektiert werden. So erscheint ein Körper beispielsweise blau, wenn seine Flächen das Tageslicht vorwiegend im Blaubereich (zwischen ca. 430 nm und 480 nm) gut reflektieren und die Strahlung der restlichen Wellenlängen absorbieren. Die wahrgenommene Farbigkeit eines Körpers ist von der Anwesenheit und der spektralen Beschaffenheit des zu reflektierenden Lichtes abhängig: Im Licht einer Natriumdampflampe, deren Emissionsspektrum sich auf den Bereich zwischen 550 nm und 620 nm (orange) beschränkt, erscheint der im Tageslicht noch blaue Körper nun schwarz, d. h. er absorbiert das von der Lampe emittierte Licht annähernd vollständig und kann nichts reflektieren, da im Blaubereich kein Licht vorhanden ist. Ohne Licht gibt es keine – zumindest bunte – Farbe. Das Schwarz wird zwar als 'unbunte' Farbe bezeichnet, stellt aber physikalisch die relative Abwesenheit von Licht (geringe Leuchtdichte) dar. Gleichzeitig ist das Weiß die relative Anwesenheit aller für den Menschen sichtbaren Spektralbereiche. In beiden Fällen meint der Begriff 'relativ', dass sich die reinen Graustufen von Schwarz bis Weiß nicht durch ihre spektrale Zusammensetzung, sondern nur im Hinblick auf ihre Leuchtdichte unterscheiden und ihre Begriffszuweisung sich daher aus dem Kontrast zueinander ergibt.

Die bunten Farben sind in den seltensten Fällen monochromatisch (d. h. mit genau einer Wellenlänge beschreibbar), sondern in der Regel Mischungen der einzelnen Spektralbereiche. Man bezeichnet die Lichtmischung auch als additive Farbmischung, da die verschiedenen Wellenlängen sich positiv überlagern.

Abbildung in dieser Leseprobe nicht enthalten

Abb. 3: a) additive und b) subtraktive Farbmischung

Werden sämtliche Wellenlängen – also alle Farbbereiche – überlagert, ergibt sich Weiß. Im Gegensatz dazu werden in der subtraktiven Farbmischung Wellenlängen negativ, sozusagen filterähnlich überlagert. Das Ergebnis der Totalüberlagerung ist Schwarz (siehe Abb. 3). Der additiven Farbmischung begegnet man z. B. am Bildschirm oder Fernseher, wohingegen sämtliche Farbdrucke oder Industriefarben subtraktiv erstellt werden.

Geht man von der Lichtmischung aus, ist die Anzahl der theoretisch möglichen Farben unendlich groß. Schließlich stellt das Wellenlängenspektrum ein Kontinuum dar und jeder Wellenlänge kann eine Farbe zugeordnet werden. Das menschliche Auge kann bis zu 20 Millionen Farbnuancen unterscheiden. Welches aber sind die Unterscheidungsmerkmale, nach denen der Mensch in der Lage ist, Farben näher zu bestimmen und zu systematisieren? Als physikalische Kategorien sind hier Farbton, Sättigung und Helligkeit zu nennen: Der Farbton wird durch die spektrale Wellenlänge bestimmt, die Sättigung nimmt ab mit dem additiven Hinzumischen von weißem Licht – also bei gleichem Zuwachs aller Spektral- bereiche und die Helligkeit wird durch die jeweilige Leuchtdichte bestimmt. Man bezeichnet diese drei Merkmale auch als Farbvalenz. Andere Kategorisierungen wie z. B. die Einteilung in warme und kalte Farben sind nicht physikalisch fassbar, sondern reine Empfindungsfragen.

Bis heute gibt es verschiedenste Versuche, die Farbenwelt in jeweils zweckdienlichen Farbordnungsmodellen zu ordnen: Von künstlerisch oder gar mystisch ambitionierten Kanons bis hin zu Farbkommunikationssystemen wie RAL („Reichs-Ausschuss für Lieferbedingungen“) oder NCS („Natural Colour System“).13 Auch die Diskussion um die Existenz und Polarität von sogenannten 'Grundfarben' gibt es bereits seit der Antike (vgl. 2.3.1), wobei der Wert solcher Systematisierungsversuche – das zeigt die Geschichte – weit über die Befriedigung einer Ordnungssehnsucht hinaus geht. Beispielsweise führte die beschriebene Vielzahl der unterscheidbaren Farbnuancen Thomas Young Anfang des 19. Jahrhunderts zur Theorie des Trichromatischen Farbensehens: Es erschien ihm unmöglich, dass der menschliche Sehapparat für jede einzelne Farbe separate Sinneszellen und Verarbeitungswege bereitstellt. Vielmehr schloss er, dass alle menschlichen Farbempfindungen auf der Wahrnehmung von nur drei Grundfarben beruhen. Hermann Helmholtz (1821-1894) erweiterte diese Theorie um die These, dass der menschliche Sehapparat dementsprechend auch genau drei unterschiedliche Rezeptorarten hervorgebracht haben müsse – je eine für Rot, Grün und Blau –, die es bei spezifisch unterschiedlicher Empfindlichkeit vermögen, jede Farbe durch das Verhältnis der Reizungszustände zueinander abzubilden. Anfang der 1960er Jahre konnte diese Theorie durch Experimente der Neurobiologie bestätigt werden. Bevor jedoch jener Zweig der Naturwissenschaft behandelt wird, soll der Blick erst einmal auf die jüngeren Erkenntnisse der Chemie gelenkt werden: Es erstaunt immerhin, wie eng diese an das eben beschriebene quantentheoretische Verständnis gebunden sind.

2.2.2 Erkenntnisse aus der Chemie

Was die Chemie mit dem Farbensehen verbindet, sind in erster Linie ihre Erkenntnisse zu den Absorptionsdispositionen der unterschiedlichen Substanzen. Wie bereits in 2.2.1 beschrieben, ist die wahrgenommene Farbigkeit eines beleuchteten Objektes vordergründig davon abhängig, welche Wellenlängen es reflektiert bzw. absorbiert und damit im Eigentlichen davon, welche chemischen Eigenschaften seine Oberfläche besitzt: Die Absorption der Lichtquanten geschieht bekanntlich auf der Ebene der Elektronen. Diese nehmen die Energie der Quanten auf und geraten in Bewegung. Dabei entstehen drei mögliche Szenarien:

a) Wenn die elektronischen Bindungskräfte der sie umgebenden Molekularstruktur ausreichend stark sind, können die Elektronen die aufgenommene Energie nur kurz halten und emittieren sie umgehend erneut in Form von Quanten – d. h. die Elektronen 'strahlen' zurück (Reflexion).
b) Lässt die Molekularstruktur dies jedoch zu, so beginnen sie zu schwingen und brauchen die eben erhaltene Energie damit auf (Absorption).
c) Schwingen die betreffenden Elektronen allerdings so stark, dass die Bindungen aufbrechen, kann die Moleularstruktur sich dadurch umstellen und ggf. sogar eine neue chemische Substanz entstehen.

In der Realität geschehen zumindest a) und b) meist parallel zueinander, d. h. nicht- transparente chemische Stoffe absorbieren das Licht spezifischer Wellenlängenbereiche und emittieren die nicht umgesetzte Energie wiederum in Form von Licht in den resultierenden Wellenlängen. Bedeutsam für die Farbigkeit bestimmter Materialien ist also ihre chemische Eigenschaft, Elektronen zur Verfügung zu haben, die so leicht gebunden sind, dass sie relativ frei schwingen können. Treten in den betrachteten Molekülen oder Atomen nur einfache σ- Bindungen auf, so ist die Energie, die benötigt wird, um die entsprechenden σ-Elektronen anzuregen, zu groß. Leichter gelingt die Anregung jener Elektronen, die in so genannten π- Bindungen, also z. B. ungesättigten Bindungen auftreten. So beruht beispielsweise die Farbigkeit von organischen Farbstoffen auf konjugierten π-Mehrfachbindungen („Chromo- phoren“). Die umgebende Molekularstruktur entscheidet darüber, welche Wellenlänge des Lichtes absorbiert wird. Weiterhin können spezielle Nebengruppen (z. B. eine Sulfogruppe) als Farbvermehrer („Auxochrome“) auftreten: Die Vielzahl der natürlichen Farben beruht nicht zuletzt auf der Vielzahl chemischer Kombinationsmöglichkeiten. Das folgende Kapitel wird zeigen, dass der Mensch für den Sehvorgang sogar körpereigene Farbstoffe nutzt, die insbesondere nach dem oben beschriebenen Prinzip c) reagieren.

2.2.3 Erkenntnisse aus Neurobiologie, Physiologie und Genetik des Menschen

Ähnlich wie im Bereich der Chemie sind die meisten der heute bekannten neurobiologischen Erkenntnisse auf dem Gebiet der visuellen Wahrneh- mung noch relativ jung. Deshalb wird dieses Kapitel keine historischen Betrachtungen in bisher gewohnter Manier enthalten, sondern die gegenwärtig gültigen Erkenntnisse in erster Linie beschreibend behandeln. Beispielhaft für diesen Fachbereich sollen vorab dennoch mit S. Howard Bartley (1901-1988), Stephen Kuffler (1913-1980) und David H. Hubel (1926-) einige bedeutende Namen genannt werden.

Abbildung in dieser Leseprobe nicht enthalten

Abb. 4: Schnitt durch das menschliche Auge mit vergrößertem Netzhautausschnitt – die Retina ist in Wirklichkeit ca. 0,5 mm dick.

Quelle: modifiziert nach Hubel (1988), S. 46

Die Beschäftigung der humanen Neurobiologie mit dem Themenkomplex „Farbe, Licht und Sehen“ fängt da an, wo die Physik enden muss: im menschlichen Auge. Das im jeweiligen Sichtfeld existente Licht 'bestrahlt' das Auge.14 Das 'optische System' des Auges (Hornhaut, Linse und Glaskörper – siehe Abb. 4) bricht die Strahlen derart, dass auf der Netzhaut (Retina) ein kleines, auf dem Kopf stehendes Abbild des Sichtfeldes entsteht. Das bedeutet: Auf die Retina treffen – flächendifferenziert – Lichtstrahlen mit verschiedenen Wellenlängen und unterschiedlichen Intensitäten auf. Die Netzhaut stellt denjenigen Teil des Auges (oder vielmehr: denjenigen Teil des Gehirns15) dar, in dem der Sehvorgang im eigentlichen Sinne beginnt: Die kinetische Energie der Lichtquanten wird hier 'umgewandelt' in neuronal verarbeitbare Elektroimpulse. Dafür ist sie auf ihrer der Linse abgewandten Seite mit Photorezeptorzellen bestückt, den nach ihrer unterschiedlichen Form sogenannten Stäbchen- und Zapfenzellen. Um diese zu erreichen, muss das Licht erst zwei andere, mehr oder weniger diaphane Schichten durchstrahlen. (Der Grund hierfür ist bis heute nicht genau bekannt.) Die Anzahl der Stäbchen und Zapfen variiert stark über die Netzhautfläche, wobei im Gebiet des Netzhautmittelpunktes, der sogenannten 'Foeva centralis' (nicht in der Abbildung), keine Stäbchen, dafür aber die Zapfen in ihrer höchsten Dichte vorkommen. Gleichzeitig ist dies der Bereich der höchsten Bildauflösung. Die Stäbchen, die insgesamt in weit größerer Zahl vorkommen, sind für das Dämmerungssehen verantwortlich und funktio- nieren nur bei schwacher Beleuchtung. Sie können nur Leuchtdichteschwankungen wahrneh- men. Dementsprechend sieht der Mensch im Dunkeln nur verschiedene Graustufen. Die Zap- fen wiederum reagieren nicht auf schwaches Licht, können aber bei genügender Beleuchtung feine Details und vor allem Farben wahrnehmen. Daher gibt es – in Bestätigung der obig genannten Young-Helmholtzschen Trichromatischen Theorie – drei zu unterscheidende Zapfentypen. Man kann insgesamt also von vier verschiedenen Rezeptorzelltypen sprechen.

Was geschieht nun in den ca. 125 Millionen Rezeptorzellen im menschlichen Auge? Um ihre Funktionsweise zu verstehen, müsste erst einmal geklärt werden, wie das Nervensystem generell funktioniert. Die detaillierte Beschreibung dessen würde hier jedoch zu weit führen. Deshalb muss im Folgenden das Wissen um den Aufbau von Nervenzellen (Neuronen), die Art und Weise der Nervenimpulsleitung innerhalb des Neurons und an den Synapsen als vorausgesetzt gelten. Es ist weiterhin bekannt, dass das Licht in Form von 'einschlagenden' Photonen auf die Materie – in diesem Falle auf die Photorezeptorzelle – einwirkt (vgl. 2.2.1). Genauer: Die Lichtquanten werden von einem in den Sehzellmembranen vorhandenen Farbstoff absorbiert. Dieser Sehfarbstoff ist ein Chromoproteid aus Retinal und dem Protein Opsin. Letzteres ist das größere Teil von beiden und in allen Zelltypen identisch. Retinal – der im eigentlichen Sinne funktionale Pigmentteil – unterscheidet sich jeweils in seiner Aminosäuresequenz. Die Absorption des Photons leitet einen sogenannten Transduktionsprozess in der Rezeptorzelle ein: Unter dem Eindruck des Quants verändert das Retinal bei Energieabgabe seine molekulare Konfiguration und setzt damit eine chemische Reaktionskette in Gang. Diese führt durch das Entstehen eines Kanalproteins letztlich zum Schließen der zelleigenen Natrium-Ionen-Schleusen und so zu einer Hyperpolarisation bzw. zur Freisetzung chemischer Transmitter an der Synapse.16 Damit kontinuierliches Sehen überhaupt möglich ist, werden die Sehfarbstoffe immer wieder hergestellt. Die verschiedenen Varianten des Retinals unter- scheiden sich in ihren relativen Empfindlichkeiten gegenüber dem Licht. Folglich sind die vier Rezeptorzelltypen was ihre Absorptionsfreudigkeit anbelangt durch ihre spezifischen Sehfarbstoffe auf klar umrissene Wellenlängenbereiche geeicht (vgl. Abb. 5). Die Zapfen unterscheidet man deshalb in L-, M- und S-Typen, wobei die Buchstaben den bevorzugten Wellenlängenbereich anzeigen (engl.: „long“, „middle“ und „short“). So haben die L-Zapfen ihr Absorptionsmaximum bei 564, die M- und S-Typen die ihrigen jeweils bei 530 und 437 nm und werden manchmal auch nicht ganz korrekt als „rote“, „grüne“ und „blaue“ Zapfen bezeichnet: Jede Klasse für sich ist nicht im Stande, Farben zu unterscheiden.

Abbildung in dieser Leseprobe nicht enthalten

Abb. 5: Absorptionsspektren der drei Zapfen- zelltypen L (rot), M (grün) bzw. S (blau) und der Stäbchenzellen (schwarz)

Quelle: modifiziert nach Maffei (1995), S. 105

Für Farbdifferenzierungen müssen mindestens zwei Zapfenklassen vorhanden und aktivierbar sein, deren momentane Aktivitäten miteinander verglichen werden können. Lückenlose Vergleichbarkeit ist nur deshalb möglich, weil sich die einzelnen Empfindlichkeitsbereiche überschneiden. So ist jede Farbe im spektralen Kontinuum durch ein spezifisches Aktivierungsverhältnis der 3 Zapfentypen codiert. Ist nur eine Zapfenklasse nicht vorhanden oder funktionsunfähig, d. h. ist der entsprechende Sehfarbstoff nicht verfügbar, kommt es zu Verzerrungen bei der Farbwahrnehmung. Konkret handelt es sich in diesem Fall um die angeborenen Formen der Farbanomalie oder gar der Farbblindheit für Rot („Protanopie“: L-Zapfen fehlen), Grün („Deuteranopie“: M-Zapfen fehlen) und Blau-Violett („Tritanopie“: S-Zapfen fehlen)17. Die bei Dämmerlicht arbeitenden Stäbchen hingegen arbeiten allein und ohne Vergleichsmoment. Daher kann ihre Aktivität keine Farbigkeit, sondern nur Helligkeitsunterschiede abbilden. Der Farbstoff der Stäbchen – das Rhodopsin – hat seine höchste Empfindlichkeit bei 498 nm.

An dieser Stelle soll kurz die Betrachtung der genetischen Dispositionen für das Farbensehen eingeschoben werden.18 Die 'Baupläne' für die verschiedenen Varianten des Opsins sind in den menschlichen Genen angelegt. Dabei befinden sich jene Teile der menschlichen Erbmoleküle, die die Informationen für den die unterschiedlichen Sehfarbstoffe enthalten – hier vereinfachend 'Blau-', 'Grün-' und 'Rot-Gen' genannt – an separaten Plätzen, teilweise sogar auf verschiedenen Chromosomen. (Während Rot- und Grün-Gen(e)19 nebeneinander auf dem X-Chromosom liegen, ist das Blau-Gen auf einem der 22 Autosomen zu finden, namentlich auf dem Chromosom 7.) Durch Crossing-Over-Effekte bei der Rekombination der DNA während der ersten Reifeteilung (Meiose) der befruchteten Eizelle kann es zur Zerstörung von Erbinformationen kommen, die nur noch durch intakte Kopien wieder korrigiert werden können. Wenn dieser Umstand das eine Rot- oder alle Grün-Gene trifft, führt es bei den sich entwickelnden Personen zu einer angeborenen Farbenblindheit. Da Männer im Gegensatz zu Frauen nur eine Kopie des X-Chromosoms besitzen, können eventuelle Mutationen nicht wieder korrigiert werden. Dies ist auch der Grund, warum viel mehr Männer als Frauen (ca. 9% : 1%) farbenblind sind. Es gibt allerdings auch die Möglichkeit, dass bei einem Crossing-Over die Erbinformation nicht vollständig zerstört, sondern nur verändert wird. Als solche kann die Tatsache angesehen werden, dass gegenwärtig zwei verschiedene Rot-Gen-Varianten bekannt sind. Die mutierte Form des Gens enthält einen leicht veränderten Bauplan des Opsins, der sich nur durch eine Aminosäure von dem Original unterscheidet. So winzig der Unterschied im molekularen Bereich auch erscheint – die entsprechenden Personen sind höher empfindlich für rotes Licht. Die individuellen genetischen Voraussetzungen sind also grundlegend und eröffnen dem Menschen erst die Möglichkeit, Farben zu unterscheiden.

Zurück zu den physiologischen Gegebenheiten: Die Rezeptorzellen unterscheiden sich also durch die verschiedenen Sehfarbstoffe in ihren Empfindlichkeitsbereichen gegenüber dem eintreffenden Licht und produzieren entsprechende Signale. Diese werden allerdings nicht getrennt ans Gehirn geschickt, sondern laufen bereits im Inneren der Retina, namentlich in den mehr als eine Million Ganglienzellen zusammen. Das bedeutet: Mehrere Zapfen sind über die Bipolarzellen mit einem oder mehreren Ganglien verknüpft und bilden sogenannte rezeptive Felder, welche sich gegenseitig überlappen und die Netzhaut lückenlos abbilden.20

Jedem Ganglion ist ein solch modellhaft kreisförmiges Feld zugewiesen. Horizontal- und möglicherweise auch Amakrinzellen sind an der Aufteilung der rezeptiven Felder beteiligt. Die Ganglienzellen treten ebenfalls in dreifacher Variation auf. Jedoch beziehen sie sich funktionell – anders als die Zapfen – nicht auf die Verarbeitung je einer Grundfarbe, sondern auf die Kodierung der drei Opponentpaare „Blau-Gelb“, „Rot-Grün“ bzw. „Hell-Dunkel“. Damit bestätigt sich die Annahme Ewald Herings (1834-1918), der schon 1878 in seiner Gegenfarbtheorie annahm, dass es im menschlichen Sehapparat antagonistische Abbildungsprozesse für die Rot-Grün-, Blau-Gelb- und Schwarz-Weiß-Empfindung geben müsse. Durch flächen- und funktionsdifferenzierte Hemmung und Überlagerung interpretieren die drei Ganglienzelltypen die eintreffenden ON/OFF-Signale und leiten die Ergebnisse als Signalkombinationen über getrennte Nervenbahnen weiter, d. h. bis in die Verarbeitungszentren des Gehirns bleiben die Farbinformationen antagonistisch getrennt.

Nachdem nun die mit den Augen aufgenommenen Farbinformationen durch die Vorgänge in der Retina in spezifische neuronale Impulsfolgen umgewandelt worden sind, treten sie über die Axome der Ganglienzellen, die sogenannten Sehnerven, ihren Weg in das visuelle Zentrum der Hirnrinde an. Abbildung 6 gibt einen schematischen Überblick über den Verlauf der Sehbahn und die wichtigsten zentralen Sehzentren: Die beiden aus den Augen kommenden Sehnerven tauschen im Chiasma opticum (Sehnervkreuzung) einen Teil ihrer Fasern aus, sodass die linken Gesichts- feldhälften beider Augen im rechten und die rechten Gesichtsfeldhälften wiederum im linken Teil des visuellen Cortex abgebildet werden (in der Abbildung wird dies durch die Farben Grün bzw. Violett angedeutet).21 Erste Stationen der Sehbahn sind die seitlichen Kniehöcker (Corpora geniculata laterale = CGL), ihrerseits Kerngebiete des Thalamus. Hier werden die Informationen in insgesamt sechs Neuronenschichten – immerhin vier davon behandeln die Farbigkeit – zwar neu verschaltet, jedoch nicht tiefgreifend umgewandelt. Der Ausgang der CGL führt jeweils als Sehstrahlung (Radiatio optica) zur primären Sehrinde (visueller Cortex) im Hinterhauptslappen der Großhirnrinde.

Abbildung in dieser Leseprobe nicht enthalten

Abb. 6: Sehbahn im menschlichen Gehirn von den Augen bis zum primären visuellen Cortex, von unten gesehen

Quelle: modifiziert nach Hubel (1988), S. 70

Der visuelle Cortex ist das eigentliche Sehzentrum. Seine verschiedenen Bereiche und Ebenen sind hoch spezialisiert und analysieren in Zusammenarbeit mit anderen relevanten Teilen des Großhirns sämtliche Dimensionen der empfangenen optischen Informationen (Form, Gestalt, Bewegung, Perspektive, Helligkeit und auch Farbigkeit) – zeitgleich. Er weist eine 'retinotope' Organisation auf, das bedeutet, dass jedem Teil der Netzhaut ein bestimmter Bereich in der Sehrinde zugewiesen ist. Diese Zuteilung geschieht jedoch nicht in linear- räumlicher 'Abwicklung' der Retina, sondern entspricht der jeweiligen retinalen Rezeptorzellendichte. So wird die obig genannte Foeva centralis, in der eine überproportional hohe Zapfendichte vorherrscht, auch in der Sehrinde überproportional projiziert, was wiederum Grund für die hohe Bildauflösung an dieser Stelle der Netzhaut ist.

In der Hirnrinde entsteht kein wirkliches Bild, es wird lediglich eine definierte räumliche Verteilung neuronaler Aktivität abgebildet, die von den entsprechenden Zentren des Gehirns analysiert und interpretiert werden muss. Die genauen Zellstrukturen, Verarbeitungsebenen oder Vorgänge im Cortex darzulegen, würde an dieser Stelle zu weit führen. Sie sind sehr komplex und bis heute nicht vollständig geklärt. Festzuhalten bleibt vor allem, dass, wie Roth es ausdrückt, „zwischen Licht und Farbempfindung zuerst eine Umsetzung der Wellenlängen in neuronale Erregungsmuster und dann im Gehirn eine weitere Umsetzung der neuronalen Erregungsmuster in Farbempfindung vorliegt“.22 Der Weg zur Empfindung ist allerdings aus der bloßen Betrachtung zellulärer Manifestierungen heraus schwerlich zu begreifen. Zwar lassen sich damit verschiedene visuelle Phänomene erklären – wie dies auch im weiteren Verlauf angestrebt wird (2.2.4). Was die einzelnen Farben jedoch in der menschlichen Empfindungswelt zu katalysieren, auszulösen oder zu hemmen vermögen, ist weitaus vielschichtiger: Nicht nur, dass an der Empfindung und Kontrolle von Emotionen zahlreiche kortikale und subkortikale Bereiche des Gehirns beteiligt sind: Gefühle wie Glück oder Unwohlsein sind – naturwissenschaftlich betrachtet – durch Hormone ausgelöste Körperreaktionen, also biochemische Phänomene, hervorgerufen durch externe oder interne Stimuli des Gehirns, insbesondere des Hypothalamus und Lobus limbicus. Vielmehr spielen hier sowohl die individuellen Konnotationen und Assoziationen aus der eigenen Seherfahrung sowie der Kontext der Wahrnehmung eine entscheidende Rolle.

Die Vorstellung dessen, was von den Augen optisch erfasst wurde, wird im Gehirn erst 'erdacht' bzw. konstruiert. Neben der Synchronisation beider Augen und der Berücksichtigung der Kopf- bzw. Körperhaltung beinhaltet diese ständige Interpretationsleistung des Gehirns vor allem auch den Abgleich des Jetztzustandes mit den bereits bekannten bzw. erlernten Reizmustern. Wie dies konkret geschieht, darüber gibt es verschiedene Theorien, die allerdings sämtlich weniger in den Bereich der Neurobiologie gehören. Zu nennen wären hier die Kognitionstheorie23, die Gestalttheorie24, der Empirismus25 und Ansätze wie der anthropologisch-soziologische26 oder der ökologische von J.J. Gibson (1904-1979)27. Die Forschung mit Vexierbildern (also mehrdeutigen Stimuli) zeigt jedenfalls, dass im jenem kurzen Moment, in dem der Betrachter zwischen zwei Bildinterpretationen hin- und herspringt ('Flippen'), auch unterschiedliche Gehirnareale aktiv werden. Die Interpretation des optisch Wahrgenommenen geht also weit über einen reinen Sehprozess hinaus – erst das präzise Zusammenspiel verschiedenster Teile des Gehirns weist jene Attribute zu, die in ihrer Gesamtheit zur Identifizierung des Gesehenen führen. Jene durch das Erkennen ausgelöste Empfindung, das 'Fühlen' und die damit verbundenen individuellen Vorlieben und Antipathien sind damit jedoch noch lange nicht erklärt. Es steht zu befürchten, dass die Neurobiologie zwar in absehbarer Zukunft verstehen wird, was rein physiologisch im Gehirn vor sich geht und welche Schritte zur Verarbeitung visueller Informationen führen – ein im Übrigen enormer Verdienst –, dass diese Erkenntnisse der Gehirnforschung jedoch weit entfernt sind von einem wirklichen Verstehen der menschlichen Intelligenz, des Bewusst- und Unterbewusstseins oder gar des Geistes- und Seelenlebens.

2.2.4 Exkurs: Visuelle Phänomene

Die menschliche Wahrnehmung differiert deutlich von den physikalisch messbaren Gegebenheiten der Realität – unterschiedliche Reize können zu gleichen und gleiche Reize zu unterschiedlichen Wahrnehmungen führen. Unter Berücksichtigung des eben Beschriebenen soll nun kurz auf eine Auswahl bekannter visueller Phänomene eingegangen werden. Am Anfang dieser Betrachtung soll die Fähigkeit des Menschen stehen, Farben bis zu einer gewissen Toleranzgrenze28 relativ unabhängig von den Beleuchtungsverhältnissen zu 'verstehen': Ein gelbes Hemd sieht immer gelb aus, auch bei größeren Verschiebungen in der spektralen Zusammensetzung der Lichtquelle wie etwa beim Übergang vom Tageslicht zur Wolframbeleuchtung. Man nennt dieses Phänomen auch Farbkonstanz.29 Insbesondere der Amerikaner Edwin Herbert Land (1909-1991) experimentierte zu diesem Thema und stellte 1986 seine Retinex-Theorie (Zusammensetzung aus 'Retina' und 'Cortex') auf, nach der die Farbe eines Objektes nicht einfach davon abhängt, welche Zapfenzelltypen in der Netzhaut wie stark stimuliert werden, sondern vielmehr von einem Vergleich mit den Objekten in der Umgebung, die unter denselben Lichtverhältnissen stehen. Durch diesen im Cortex30 stattfindenden Vergleich können Unterschiede verschiedener Lichtquellen ausgeglichen werden und die Farbe des Objektes ist nur noch von seinen Reflexionseigenschaften abhängig.

Dem gegenüber steht das Phänomen der Metamerie: Zwei unter Lichtquelle A als identisch wahrgenommene Farben (sogenannte 'Metamere') können unter Lichtquelle B verschieden wahrgenommen werden. Der Mensch ist nicht in der Lage, die Zusammensetzung von Licht zu ermitteln, d. h. das zu analysierende Licht in seine Spektralfarben zu zerlegen. Licht unterschiedlichster Zusammensetzung kann jedoch denselben Augenschein erwecken: Einen gelben Farbeindruck erhält man z. B. nicht nur, wenn reines monochromatisches Licht der Wellenlänge 600 nm, sondern auch, wenn gleichzeitig monochromatisches rotes Licht der Wellenlänge 700 nm und monochromatisches grünes Licht der Wellenlänge 500 nm auf die Netzhaut trifft. Verändern sich die Beleuchtungsverhältnisse in ihrer spektralen Zusammensetzung, so können auch die Farbeindrücke divergieren.

Ebenso bemerkenswert ist der nach Johannes Evangelista Purkinje (1787-1869) benannte Purkinje-Effekt: In der Dämmerung wird mit zunehmender Helligkeit zuerst Blau und dann Rot sichtbar, obwohl beide mit derselben Leuchtdichte leuchten und sich die spektrale Zusammensetzung des Lichts nicht verändert. Dies ist durch die unterschiedlichen Aktivitäten der retinalen Rezeptorzellen zu erklären. Beim Übergang vom Nacht- zum Tagsehen werden fließend die dämmerlichtaktiven Stäbchenzellen deaktiviert und die tageslichtaktiven Zapfen aktiviert. So kommt es zu Hellempfindlichkeitsverschiebungen zwischen dem Nacht- und Tagsehen (vgl. Abb. 2) und dementsprechend zu unterschiedlicher Intensitätswahrnehmung.

Ein weiteres Phänomen sind die Kontraste, also die scheinbare Verstärkung von Unterschieden zweier Reize aus derselben Sinnesmodalität (Farbe, Form oder Größe). Bekannt und in der Farbgestaltung nutzbar gemacht sind z. B. der Farbe-an-sich-Kontrast, der Komplementärkontrast, der Hell-Dunkel-Kontrast, der Warm-Kalt-Kontrast, der

Qualitätskontrast (gesättigt vs. vergraut) oder der Quantitätskontrast (groß- vs. kleinflächig).31 Der Simultankontrast in allen seinen Spielarten beinhaltet speziell die Veränderungen und Überlagerungen der Farbwahrnehmung unter dem Einfluss anderer, unmittelbar nachbarschaftlich positionierter Farben: Ein und dieselbe Farbe wirkt vor einem dunklen Hintergrund heller und vor einem hellen Hintergrund dunkler. Ein heller Hintergrund lässt eine Farbe in den Vordergrund rücken, ein dunkler nimmt sie zurück. Unbunte

Umgebungen, insbesondere Schwarz, bringen bunte Farben stärker zum Leuchten. Auch der Farbton verändert sich. Hervorzuheben ist hier:

a) die sogenannte Komplementärverschiebung: Eine gelbe Fläche auf grünem Hintergrund wirkt orange, während sich dieselbe Fläche auf rotem Hintergrund ins Grünliche zu verfärben scheint. Weiß vergilbt neben einem starken Blau, wohin gegen dasselbe Weiß neben einem intensiven Gelb eher bläulich wirkt.
b) die Assimilation: Im dichten Muster aus Rot und Gelb erscheint Rot gelblich und Gelb rötlich. Die Farben nähern sich gegenseitig an, da die Sehschärfe bei Farbkontrasten nur ca. ein Drittel so hoch aufgelöst ist wie die der Hell-Dunkelkontraste. Sie werden überlagert und bei sehr hoher Dichte miteinander verschmolzen.

Die Simultankontraste sind im eigentlichen Sinne simultane Grenzkontraste, d. h. sie treten nur in unmittelbarer Nähe der Farbgrenzen auf. Bei genauerem Betrachten dieser Grenzbereiche fallen kontrastüberhöhende Farbbänder auf – jene von Ernst Mach (1838- 1916) bereits 1865 entdeckten und nach ihm benannten 'Mach-Bänder'. Sie stellen einen wichtigen Mechanismus dar, der die Sehschärfe und das Formensehen verbessert, und lassen sich aus der funktionellen Organisation der rezeptiven Felder von retinalen Ganglienzellen und CGLs heraus verstehen: Bei der Verschlüsselung des Netzhautbildes in Nervensignale werden Informationen über Kontrastbereiche gegenüber denen gleichförmig ausgeleuchteter Bereiche durch das gegenseitige Hemmen bzw. Stimulieren benachbarter Zellen bevorzugt und überhöht. Daher kann das Sehzentrum Unterschiede zwischen ähnlichen Arealen wahrnehmen, aber es entstehen auch Täuschungen.32

Interessant ist in diesem Zusammenhang auch der Sukzessivkontrast, also ein zeitlich versetztes Nachbild des optisch Wahrgenommenen. Dieses besitzt im Vergleich zum originalen Seheindruck zwar dieselbe Formgebung, jedoch nicht zwangsläufig auch dieselbe Farbgebung. Vielmehr gibt es positive und negative (komplementäre) Nachbilder.33 Letztere entstehen anscheinend durch die Trägheit des lokal adaptierten Auges: Trifft ein homogener Lichtreiz auf Bereiche der Netzhaut, die durch einen vorhergehenden Reiz unterschiedlich adaptiert sind, werden besagte Bereiche unterschiedlich stark erregt. Das subjektive Resultat ist ein Nachbild in der Gegenfarbe.34 Es gibt auch positive Nachbilder – beispielsweise nach dem Fixieren einer hellen Lichtquelle – die wahrscheinlich durch oszillatorische, also selbstaktive Erregungsprozesse in der Netzhaut zustande kommen. Die beschriebenen Erklärungsansätze werden jedoch noch kontrovers diskutiert.

Als Nächstes soll das Phänomen der farbigen Schatten dargestellt werden. Diese sind auf drei verschiedene Effekte zurückzuführen:

a) Bei natürlicher Beleuchtung treten Wechselwirkungen mit der Eigenfarbe des Objektes auf, d. h. bei Tageslicht sind die Schattenbereiche nicht vollständig dunkel, sondern durch spektral blauverschobenes Streulicht (Himmelsblau) aufgehellt, also bläulicher als die im direkten Sonnenlicht stehenden Objektflächen. Dieser Effekt wird besonders deutlich im Fall diffus reflektierender Flächen, etwa einer farbig verputzten Hauswand oder einer rein weißen Neuschneefläche.
b) Wenn ein Objekt von mindestens zwei verschiedenfarbigen Lichtquellen beleuchtet wird, sind die entstehenden Halbschatten farbig. Hierbei wird der Schattenbereich der einen Lichtquelle ganz einfach von jener zweiten Lichtquelle eingefärbt, die diesen Bereich dennoch bestrahlt.
c) Andererseits können farbige Schatten auch wahrgenommen werden, wenn ein Objekt mit intensiv farbigem Licht von nur einer Quelle bestrahlt wird. Die in diesem Fall entstehenden Schatten nehmen dann einen Farbton an, der der Komplementärfarbe des Lichtes entspricht. Bis heute gibt es noch keinen eindeutigen Erklärungsansatz für diesen Effekt. Speziell Johann Wolfgang Goethe (1749-1832) hat sich in seine »Farbenlehre« mit diesem Phänomen auseinander gesetzt – allerdings weniger auf naturwissenschaftliche, als vielmehr auf naturphilosophische Weise. Die Kontroverse, ob es sich hierbei nur um einen subjektiv wahrgenommenen (also im Gehirn 'konstruierten') oder doch um einen objektiv messbaren Effekt handelt, kann bis jetzt nicht abschließend geklärt werden. Während die Naturwissenschaft dieses Phänomen mehrheitlich als nicht verifizierbar ignoriert, zeigen die Fotografien eines Hans Georg Hetzel (1929-), dass offenbar eine Farbigkeit jener Schatten tatsächlich vorliegt.

Zu guter Letzt gibt es wohl kaum ein Farbphänomen, das unnahbarer wäre als die unter dem Begriff 'Farbenstereoskopie' oder 'Farbtiefeneffekt' schon seit dem 18. Jahrhundert bekannte räumliche Farbwirkung: Die beobachtbaren und auf den ersten Blick scheinbar gesetzmäßig auftretenden Raumwirkungen sind bei näherer Betrachtung allerdings sehr relativ und können sogar manchmal ins Gegenteil 'kippen': Im Allgemeinen kann davon ausgegangen werden, dass z. B. Rot und Gelb dem Betrachter räumlich näher erscheinen als Grün oder Blau. Ein Erklärungsansatz hierfür ist die chromatische Aberration – der unterschiedliche Brechwert des menschlichen Auges für langwelliges bzw. kurzwelliges Licht. So werden beispielsweise zwei Punkte (rot und blau), die sich in gleichem Abstand vom Auge befinden, auf unterschiedliche Positionen der Netzhaut abgebildet – der rote vielleicht innerhalb der Foeva, der blaue etwas seitlich daneben. Es kommt – vor allem beim binokulären Sehen – zu einem Stereoeffekt, der vom Gehirn räumlich interpretiert wird und den roten Punkt dem Auge näher erscheinen lässt als den blauen.35 Diese Erscheinung kann sich jedoch verändern und sogar umkehren, wenn die Helligkeit des Vorder- und des Hintergrunds, die Größe der betrachteten Farbflächen oder die gesamträumlichen Gegebenheiten variiert werden: Während sich Gelb auf Schwarz nach vorne hin absetzt, tritt es auf weißem Hintergrund zurück. Ein helles Gelb, welches im Außenbereich auf den Betrachter zuzukommen scheint, kann im Innenraum durchaus eine erweiternde Wirkung haben. Aus der gewählten Formulierung geht bereits hervor, dass das menschliche Gehirn den Farben nicht nur statisch-räumliche Positionierungen zuschreiben kann, sondern sogar Bewegungs formen36. Damit wird klar, dass die chromatische Aberration nur einen kleinen Teil des Effektes zu erklären vermag. Offenbar hängt die tatsächliche Raumwahrnehmung auch von vielen anderen Faktoren ab, die das Gehirn miteinander 'verrechnet', wie beispielsweise von den Fragen,

a) welche Kontraste die Szene in welcher Intensität durchsetzen

(kontrastreich – räumlich nah, kontrastarm bzw. verschwimmend – räumlich fern),

b) welche Raum-Assoziationen

(z. B.: Hellblau – Himmel – Weite, Gelb – Blume – Nähe), bzw.

c) welche Wärme-Assoziationen mit den einzelnen Farben bereits verknüpft sind. (warme Farben – räumlich nah, kalte Farben – räumlich fern)

Speziell bei den räumlichen Farbwirkungen bleiben viele Fragen offen und bieten nach wie vor Raum für Hypothesen und Spekulationen. Diverse Künstler und Philosophen haben sich mit ihnen auseinander gesetzt (vgl. 2.3.1).

2.2.5 Die Grenzen der Naturwissenschaft

Die bisherigen Betrachtungen haben eines deutlich gemacht: Die rasanten Fortschritte der Naturwissenschaft insbesondere in den letzten 30 Jahren ermöglichen heute tiefe Einblicke in die Komplexität der Welt des Lichtes und des Farbensehens. Indes hat spätestens der letzte Abschnitt des Kapitels 2.2.3 gezeigt, dass die Naturwissenschaft ihre Grenzen dort findet, wo der eigentliche visuelle Wahrnehmungsprozess im Sinne der Attribuierung, der Beurteilung und der Empfindung erst beginnt: im menschlichen Gehirn. Dort jedenfalls werden landläufig das Denken, das menschliche Bewusst- bzw. Unterbewusstsein und die Psyche lokalisiert. Geist und Seele sind Begriffe, die aufgrund ihrer Unfassbarkeit aus den sogenannten 'exakten' Wissenschaften ausgeklammert wurden. Es gibt Bemühungen, geistige und seelische Vorgänge auf eine ausschließlich neuronale Basis zu stellen: Das Bewusstsein sei lediglich die Summe der kognitiven Neuronalfunktionen. Autoren wie z. B. Francis Crick sprechen dem Menschen selbst die Willensfreiheit ab.37 Binäre Systeme sind der Funktionsweise des Gehirns nachempfunden und kommen speziell im Computerbereich zur Anwendung. Speicherung und Vergleich von Informationen sind praktisch möglich und werden vielfach praktiziert. In diesem Sinne können heute schon Ansätze künstlicher Intelligenz entwickelt werden. Offenbar ist es möglich, die menschliche Logik auch logisch zu erklären.

Ob das Entstehen von Stimmungen, Vorlieben, Ideen, Sehnsüchten und Poesie hingegen unbedingt auf Logik zurückzuführen ist, darf bezweifelt werden. Die mechanistische, materialistische Weltanschauung hinterlässt nicht nur offene Fragen und aus ihrer Sicht unerklärbare Phänomene, sondern sie reduziert den Menschen vor allem allein auf einen funktionellen Teil: Das kreative Denken negiert sich selbst. Das verwundert um so mehr, als die strikte Trennung von Physik und Philosophie eine neuzeitliche Erscheinung ist. Der anschließende zweite Komplex dieser Arbeit soll die Sichtweisen jener Disziplinen darlegen, die gemeinhin unter dem Begriff Geisteswissenschaft zusammengefasst werden. Es liegt in der Natur der Sache, dass diese anders lautende Fragen stellen. Beschränkt sich die Naturwissenschaft vor allem auf den Vorgang des Farbsehens – also sozusagen auf die vorausgehenden Bedingungen einer Farbempfindung – so sollen im Folgenden eher Schlussfolgerungen zur anschließenden Wirkung der Farbe auf die menschliche Psyche (und mithin auch Physe) dargestellt werden. Dabei soll eine Trennung zwischen den akademischen Geisteswissenschaften (2.3) und den mystischen bzw. metaphysischen Ansätzen38 (2.4) vollzogen werden. Die Grenze zwischen beiden Bereichen ist weniger eindeutig, als es hier vorerst erscheint und soll daher auch nicht in dogmatischem Sinne verstanden werden. Sowohl Philosophie und Religion, als auch die bildende Kunst sind Fachgebiete, die durchaus in beide Bereiche gehören.

2.3 Farbe, Licht und Sehen in der Geisteswissenschaft

2.3.1 Kulturhistorische und philosophische Ansätze

Mit dem Sehen und insbesondere mit dem Sehen von Farben beschäftigten sich bereits die Philosophen der Antike.39 Während Empedokles (495-435 v.Chr.) und nach ihm Platon (428-348 v.Chr.) und die Stoiker von einer Strahlentheorie40, also von einem aktiven Sehprozess ausgingen, charakterisierte Demokrit (460-371 v.Chr.) das Auge als passives Wahrnehmungsorgan und entwickelte eine atomistische Abbildtheorie41, die ihrerseits von der Schule der Epikuräer übernommen wurde. Aristoteles (384-322 v.Chr.) blieb bei diesem passiven Ansatz, brachte jedoch die Farben erstmalig in einen Zusammenhang mit dem Licht. Seine Erregungstheorie besagte, dass die Farben als Lichtphänome mit ihrer jeweiligen spezifischen Energie die Luft in Erregung versetzten, welche dann in den menschlichen Augen die Wahrnehmung evozierten. Parallel dazu wurden von denselben Protagonisten immer auch Versuche unternommen, Farbordnungssysteme aufzustellen, namentlich Grundfarbsysteme. So kombinierte Empedokles vier Grundfarben mit den vier Elementen (Weiß – Feuer; Schwarz – Wasser; Rot – Erde; Blassgelb – Luft). Platon erkannte drei Grundfarben (Weiß, Schwarz, Rot), wohingegen Aristoteles mit einem Farbenfünfklang auf seine Vorstellung vom Lichtcharakter der Farben aufbaute: Rot, Grün und Violett als Mischungen von Weiß (Licht) und Schwarz (Finsternis). Die aristotelischen Lehren wurden neben den Epikuräern auch von Seneca (4 v.Chr. – 65 n.Chr.) sowie Plutarch (45-120 n.Chr.) übernommen und blieben gängig bis ins hohe Mittelalter. Während Selbiges aufgrund religiöser Fixierungen außer der allegorischen Verwendung keine nennenswerten eigenen Überlegungen über Farbe und Farbordnungen hervorbrachte, wurden im 15. und beginnenden 16. Jahrhundert erneut Versuche unternommen, die Farbe zu kategorisieren. Herauszustellen sind hier die Überlegungen von Leon B. Alberti (1404-1472), Leonardo Da Vinci (1452-1519) und Anselm B. De Boodt (1550-1633). Alberti belebte die Farbelementenlehre des Empedo- kles aufs Neue und entwickelte sie mit anderen Farben (Rot, Grün, Blau, Bleigrau) weiter. Bei ihm sind Schwarz und Weiß erstmalig keine eigentlichen Farben, sondern nur Modellierungswerte. Da Vinci übernahm diese Ansätze und ersetzte das Bleigrau durch Gelb, womit erstmalig alle vier Grundfarben im Heringschen Sinne kanonisiert wurden. De Boodt legte sich hingegen auf die drei Grundfarben der subtraktiven Farbmischung fest (Gelb, Rot, Blau), interpretierte Weiß und Schwarz als Helligkeitswerte und legte damit den Grundstein für wichtige neuzeitliche Farbsysteme wie z. B. die Farbkugel des Philipp Otto Runge (1777- 1810).

Mit den bereits in 2.2.1 beschriebenen Entdeckungen von Isaak Newton beginnt Ende des 17. Jahrhunderts eine neue Ära. Die Aussage, dass weißes Licht sämtliche Farben enthalte, diese damit also ausschließlich Phänomene des Lichts und seiner Brechungen seien, fand nicht nur Zustimmung. Besonders Johann Wolfgang Goethe wandte sich dem aufgrund eigener Studien und Experimente entgegen: Seiner dualistischen Naturauffassung zufolge musste Farbe das Produkt von Licht und Finsternis sein. In der 1810 erschienenen »Farbenlehre« geht er daher von zwei gegensätzlichen Grundfarben an den jeweiligen Grenzen von Licht (Gelb) und Finsternis (Blau) aus. Rot und Grün seien Kulminations- bzw. Vermittlungsfarben zwischen den entsprechenden Energieniveaus.42 Selten hat sich die Spaltung zwischen Funktionalitäts- und Wesensbetrachtung, zwischen Physik und Philosophie, so polemisch manifestiert, wie in dem langjährigen Streit zwischen den Anhängern dieser beiden Lehren.43 So nimmt es denn nicht Wunder, dass die Anhänger Goethes hauptsächlich der Psychologie, Philosophie, Kunst und Metaphysik entstammten, jenen Bereichen also, die sich naturgemäß mit der Wirkungs-, weniger mit der Funktionsweise der Farben beschäftigten: Friedrich W. Schelling (1775-1854), Rudolf Steiner (1861-1925), Wassily Kandinsky (1866-1944) und Johannes Itten, um nur wenige zu nennen. Die Bedeutsamkeit der Goetheschen Farbenlehre ist allerdings weniger seiner Polemik gegenüber Newton zuzuschreiben, als vielmehr den weitreichenden empfindungs- theoretischen Betrachtungen der »sinnlich-sittlichen Wirkung« der Farben. Goethe teilte sie in aktiv (anregend bzw. dem Betrachter entgegenkommend = Gelb bis Rot) und passiv (vom Betrachter weichend = Violett bis Blau) ein und sprach ihnen spezifische Energien zu. Er postulierte, dass Farbe unabhängig von der Form auf das menschliche Empfinden wirke – einerseits für sich allein, andererseits in harmonischen, charakteristischen oder charakterlosen Zusammenstellungen. Philipp Otto Runge erweiterte die Goetheschen Empfindungstheorien und ging davon aus, dass die verschiedenen Farb(harmoni)en spezifische Gefühle im Menschen auslösten. Er beschrieb Farbzusammenstellungen – wie Goethe – in drei Kategorien: Nach seiner Ansicht wirkten Komplementärfarben immer harmonisch und Grundfarbzusammenstellungen eher disharmonisch, unmittelbare Nachbar- farben erschienen miteinander jedoch monoton. Während sein Zeitgenosse und Physiker Thomas Young und später auch Hermann Helmholtz im Rahmen der Trichromatischen Theorie Rot, Grün und Violett (Blau) zu den elementaren Grundfarben erklärten, berief sich Runge unter anderem auf De Boodts Vorstellungen. Er unterstellte sogar eine metaphysische Dimension und betrachtete Farbe als eine göttliche Offenbarung. Dabei bildeten die Grundfarben Rot, Gelb und Blau die göttliche Trinität nach. Philosophie und Metaphysik griffen hier – wie an vielen Stellen – ineinander.

Auch Wassily Kandinsky konnte sich einer übersinnlichen Terminologie nicht entziehen. Im Hinblick auf die Relevanz für spätere Betrachtungen sollen seine Aussagen hier etwas ausführlicher dargestellt werden: Für Kandinsky nimmt der Mensch die Farben in drei Schritten wahr: Nach einer grundsätzlichen physischen Konfrontation verknüpfe er die Farben psychologisch mit seinem Erfahrungsschatz. Eine dritte, erst durch den künstlerischen, didaktischen Gebrauch der Farben erreichbare Stufe sei das sinnliche Erfassen der Farbe, die 'Vibration der Seele'44. Damit wirke die Farbe assoziativ und – entgegen der Goetheschen Annahme – in Abhängigkeit von der Form45. Daneben findet sich auch bei Kandinsky der klare Goethe-Bezug. In seiner Bewegungstheorie benannte er vier Gegensätze der Farben im Sinne der ihnen innewohnenden Bewegungen (siehe Anhang, S. A 1). So schrieb er der lichtnahen und warmen Farbe Gelb exzentrische, dem schwarznahen Blau hingegen konzentrische Bewegung zu. Außerdem trete Gelb auch horizontal aus sich heraus und komme dem Betrachter entgegen. Das kontemplative Blau hingegen ziehe sich in sich selbst zurück. In den Komplementen hebe sich die Bewegung wieder auf. Weiß und Schwarz werden als Anfangs- bzw. Endpunkt der Bewegungsfähigkeit, als lebendiges bzw. totes Schweigen verstanden und während Rot sich in sich selbst bewege, strahlten Grün und Grau stabile Ruhe aus. Das Violett wirke krank aufgrund seiner unmittelbaren Nähe zum toten, schweigenden Schwarz. Hingegen sei das Orange – das »aktive Element des Gelb in Rot« – die lebendigste Farbe. Ausgehend von der Disposition der Farben, die menschliche Seele in Vibration zu versetzen und spezifische Gefühle auszulösen, sprach Kandinsky der Kunst den pädagogischen Auftrag zu, Farben vorsätzlich und bewusst einzusetzen, um die Seele des Betrachters in bestimmte, intendierte Richtungen zu stimulieren und geistige Potentiale anzuregen. Basis dessen sollen die Kenntnis der spezifischen Form- und Farbwirkungen und der zweckmäßige Gebrauch nach dem sich ergebenden Prinzip der inneren Notwendigkeit sein.

Kandinskys Theorien waren inspiriert und wurden teilweise auch übernommen von Johannes Itten und Rudolf Steiner (vgl. 2.4.1). Dennoch sind es vor allem die Theorien Goethes, die den weitaus größten Einfluss auf ihn hatten: War doch die Goethesche für lange Zeit die einzige in sich geschlossene Farbenlehre und damit von enormer Bedeutung – bisweilen löst sie noch heute kontroverse Diskurse aus. Nur Wenige hatten sich vor ihm so konsequent mit den Phänomenen des Farbensehens auseinandergesetzt. Zu nennen wäre hier allenfalls der Philosoph und Naturwissenschaftler Arthur Schopenhauer (1788-1860). Dieser versuchte die Farbphänomene jedoch weniger zu beschreiben, als vielmehr zu erklären und nahm in seiner physiologischen Theorie an, dass die unterschiedlich starke anteilige Aktivierung spezifischer Retinateile für die menschliche Farbwahrnehmung entscheidend ist: Während bei einem weißen Farbeindruck die gesamte Retinafläche aktiv sei, aktiviere z. B. das Violett nur ca. ein Viertel aller Rezeptoren.

Solche physiologischen Rückschlüsse aus philosophischen Überlegungen heraus machen erneut deutlich, wie wenig selbstverständlich und konstruiert die heute übliche strikte Trennung zwischen Geistes- und Naturwissenschaft ist. Schopenhauer war keineswegs der einzige 'Grenzgänger' seiner Zeit – Mitte bis Ende des 19. Jahrhunderts wandten sich etliche Naturwissenschaftler noch einmal der Philosophie zu. Grund hierfür waren diverse Entdeckungen, die sich mit dem materialistischen Materiebegriff46 Paul Thiry Holbachs (1723-1789) nicht mehr erklären ließen. Ein weiterer Vertreter dieser Zeit ist der Chemiker Wilhelm Ostwald (1853-1932). Auch er wandte sich in Form seiner Energetik-Theorie der Naturphilosophie zu. Um so bemerkenswerter ist sein pragmatischer, gleichsam technokratischer Denkansatz im Bereich der Farben: Sein erklärtes Ziel war es, die Körper farben messbar zu machen und in einer harmonischen, klar definierten und – was die chemische Zusammensetzung angeht – rezeptierten Ordnung zusammenzufassen. Diese Ordnung sollte die Grundlage für industrielle Nutzungen z. B. im Textil- oder Produktdesignbereich, ja, selbst in der Kunst werden.47 Er unterschied in unbunte (die 'Grauleiter' mit den Endpunkten Schwarz und Weiß) und bunte Farben, sprach jedoch nicht von Grundfarben, sondern von acht 'Vollfarben' (Gelb, Kreß, Rot, Veil, Ublau, Eisblau, Seegrün und Laubgrün) in jeweils drei Unternuancen. Der von ihm entwickelte Farbkegel enthält 680 in gleichen harmonischen Abständen ausgemischte Körperfarbtöne und seine ausschließliche Nutzung sollte nach Ostwalds Vorstellung die überall bestehende „Unsicherheit in der Verwendung der Farbe“48 nach und nach beseitigen. Wäre diese Farbenlehre radikal und auf allen Ebenen umgesetzt worden, hätte sie fragwürdigerweise die bewusst herbeigeführte Reduzierung der alltäglich benutzten Farben zur Folge gehabt. Da dies jedoch verhindert wurde, bleibt vielmehr Ostwalds Verdienst um die Farbe herauszustellen, welcher zweifelsohne darin liegt, mehr System und Verständnis in die Farbenwelt gebracht zu haben.

Erwähnung finden sollen an dieser Stelle noch zwei jüngere Meilensteine der Farbforschung. Der ehemalige Bauhaus-Lehrer Johannes Itten veröffentlichte 1961 sein Hauptwerk »Kunst der Farbe« und begründete mit ihm seine Farbenlehre. Herauszustellen sind besonders seine Theorie der 7 Farbkontraste, die Entdeckung des sogenannten subjektiven Farbklanges jedes Menschen und die Expressive und Impressive Farbenlehre

– die grundlegend sind für die heute besonders in den Bereichen Textilmode und Kosmetik weit verbreitete Farbtypenlehre. Itten widmete sich vor allem den psychologischen und empfindungstheoretischen Entitäten der Farbe. Alternativ zu der Ittenschen entwickelte Harald Küppers in den 1970er Jahren eine weitere, in sich geschlossene Farbenlehre. Seine Überlegungen gingen von der physiologischen These aus, dass sich die Farben erst im Auge des Betrachters mischen, dort also Synthesen eingingen. Er integrierte gleichsam das subtraktive und das additive Farbsystem und entwickelte daraus sein Rhomboeder-Modell der Farben. Küppers’ Theorien widmen sich hauptsächlich der harmonischen Farbwirkung und sind weniger philosophischen Ursprungs. Sie sollen – ähnlich wie Ostwalds Entwicklungen – die praktische Farbgestaltung systematisieren und vereinfachen.

[...]


1 Zur philosophischen Diskussion über die Existenz von Seele gibt Ludwig Jaskolla in einem Seminarskript unter dem Titel »Versuch einer Annäherung an das Leib-Seele-Problem« eine gute Übersicht (siehe Quellen- und Literaturverzeichnis).

2 Zu den Dimensionen sozialwissenschaftlicher Theoriebildung vgl. Saam (2005), S. 44 f.

3 Müller-Reissmann (1992), S. 25

4 ebd., S. 26

5 Stier (2002), S. 69, vgl. auch S. 70 ff.

6 Der hier verwendete 'Natur'-Begriff ist nicht im Goetheschen Sinne zu verstehen, sondern bezieht sich auf experimentell Abprüfbares.

7 vgl. Fischer (1999), S. 80 und Fischer (1994), S. 15: Newton hat betont, dass die Teilchen selbst keine Farbe besitzen, sondern die entsprechende Erregung erst im Auge des Betrachters hervorrufen.

8 Thommes (1997), S. 25: Zwar ist um 1630 bereits ein Farbenkreis von Robert Fludd erschienen, jedoch in medizinischem Zusammenhang und wurde von der Farbenforschung kaum beachtet –

vgl. Silvestrini (1994), S. 18 und Fischer (1999), S. 83.

9 wie zitiert in: Fischer (1994), S. 14

10 Die Lichtgeschwindigkeit beträgt im Vakuum 299 792,458 km/s.

11 Erweitert um die nicht-sichtbaren Bereiche der elektromagnetischen Strahlung zeigt sich: Je nach seiner 'kinetischen Energie', die man als Strahlungsenergie identifiziert, tritt das Photon als Radioquant, Infrarotquant, optisches Quant, UV-Quant, Röntgenquant oder Gammaquant in Erscheinung. Die Letztgenannten haben die höchsten Energien. Die Energie des Quants ergibt sich aus dem Produkt von Planckschem Wirkungsquantum, und Wellenfrequenz (E = hf).

12 Sichtbares Ergebnis der Absorption von (UV-) Licht-Strahlung durch die Haut ist z. B. die Pigmentbildung und der 'Sonnenbrand'.

13 Mit seinem Katalog »Idee Farbe. Farbsysteme in Kunst und Wissenschaft« hat Narciso Silvestrini einen bemerkenswerten Überblick über die Geschichte der Farbsystematisierung von der Antike bis in die Gegenwart vorgelegt (siehe Quellen- und Literaturverzeichnis).

14 Es soll hier noch einmal darauf hingewiesen werden, dass im Gegensatz zur übrigen Körperoberfläche die Augen selektiv nur das Licht ihres jeweiligen Sichtfeldes auf- und wahrnehmen. Dennoch nimmt der Körper auch die Strahlungen auf, die über das Sichtfeld hinausgehen. Wenn man dies betreffend überhaupt von einer Art 'somatischen Wahrnehmung' reden kann, so geschieht diese weitgehend unabhängig vom Nervensystem: Der schon einmal heranzitierte Bräunungsvorgang im Sonnenlicht ist sinnlich nicht 'spürbar'. Gerhard Roth spricht z. B. von einer – jenseits der Sinneszellen – absoluten Unempfindlichkeit und Isolation des neuronalen Netzes gegenüber Umwelteinflüssen wie elektromagnetischen Wellen (vgl. Roth (1994), S. 78 f). Er begründet dies mit der Neutralität des neuronalen Codes. In diesem Sinne wäre die Reizung der Sinnesorgane die einzige Möglichkeit, auf das Bewusstsein des Menschen einzuwirken. Roth räumt aber auch ein, dass z. B. Magnetwellen und radioaktive Strahlung durchaus Wechselwirkungen mit dem Körper eingehen, obwohl sie nicht bewusst wahrgenommen werden. Die bewusste Nicht-Wahrnehmung von Umwelteinflüssen bedeutet also nicht zwangsläufig auch deren faktisches Nicht-Vorhanden-Sein oder deren Unwirksamkeit am und im Körper.

15 vgl. Hubel (1988), S. 45

16 Grundlegendes zur Transduktion in Shepherd (1988), S.178 f., 296 f. bzw. Birbaumer (1990), S.388 f.

17 Eine weitere, die erworbene Form der Farbblindheit („kortikale Achromatopsie“) ist meist auf Schädigungen der Hirnrinde zurückzuführen.

18 Zur genetischen Verankerung des Farbensehens vgl. Fischer (1994), S. 67 f.

19 Tatsächlich gibt es neben dem normalen Grün-Gen noch ein bis drei zusätzliche Kopien auf den X- Chromosomen. Das Rot-Gen ist hingegen nur einmal vorhanden. Evolutionstheoretisch wird von einem 'Ur-Gen' im Grünbereich ausgegangen, das im Laufe der Zeit durch Dopplung und Mutation zum zusätzlichen Rot-Gen und damit zum Farbensehen geführt hat.

20 Auf den sog. 'blinden Fleck' wird hier nicht weiter eingegangen, da er im Sinne des Themas irrelevant ist.

21 Zum vergleichenden Informationsaustausch, der z. B. für das stereoskopische Sehen notwenig ist, sind die rechte und die linke Hemisphäre der Sehrinde über den sogenannten 'Balken' (nicht in der Abbildung) miteinander verbunden.

22 Roth (1994), S. 105

23 Die Kognitionstheorie (= der 'Konstruktivismus') postuliert: Die Wahrnehmung ist ein Prozess der Annäherung an die Wirklichkeit über eine Hypothese oder anhand von Schlussfolgerungen, die auf Wahrscheinlichkeiten beruhen (probabilistische Folgerungen). Frühere Erfahrungen und der Kontext werden hinzugezogen. Vertreter sind u. a. Heinz von Förster (1911-2002) und Ernst von Glasersfeld (1917-).

24 Die Gestalttheorie (vormals auch 'Nativismus') schreibt dem Menschen bestimmte angeborene Mustererkennungsinstinkte zu. In ihrem Sinne ist die Wahrnehmung die nach festen Gesetzen funktionierende Organisation und einen Mehrwert erzeugende Assoziation einzelner Sinneseindrücke. Vertreter sind u. a. Kurt Koffka (1886-1941), Max Wertheimer (1880-1943) und Wolfgang Köhler (1887-1967).

25 Der Empirismus besagt, dass das Sehen gelernt werden muss. Wahrnehmungen setzten sich zusammen aus Vermutungen und Bestätigungen. Vertreter sind u. a. Herman Helmholtz und Richard Gregory (1923-).

26 vgl. Maffei (1995), S. 11: Bildliche Darstellungen sind Ausdruck einer bestimmten Gemeinschaft und können nur im kulturellen Urkontext verstanden werden.

27 vgl. ebd: Wahrnehmung geschieht nie losgelöst vom Hintergrund bzw. von der Umgebung.

28 Der obig beschriebene Blau-zu-Schwarz-Effekt unter dem Licht einer Natriumdampflampe liegt außerhalb dieser Toleranzgrenze und würde bei jedweder monochromatischen Beleuchtung ebenso ausfallen.

29 vgl. Maffei (1995), S. 111; Fischer (1994), S. 22 f.; Hubel (1988), S. 179 f., S. 188

30 Hubel (1988), S. 188: Die Wahrnehmung räumlicher Farb-Wechselwirkungen (Farbkonstanz etc.) wird wahrscheinlich von Doppelgegenfarbzellen im Cortex berechnet.

31 Die Kontraste wurden eingehend von Adolf Hölzel (1853-1934) und Johannes Itten (1888-1967) behandelt.

32 vgl. Maffei (1995), S. 26; Birbaumer (1990), S. 376, S. 391

33 vgl. Maffei (1995), S. 25, 112 f, Birbaumer, S. 374 f.

34 Es fällt auf, dass die wahrgenommene Gegenfarbe nicht wie zu erwarten dem antagonistischen Farbpartner im Heringschen Sinne entspricht: Das Nachbild eines roten Kreises ist z. B. kein grüner, sondern vielmehr ein türkiser Kreis. Farbmodelle wie das von Harald Küppers (1928-) bilden indessen die durch Nachbilder wahrgenommenen Komplementaritäten realitätsnäher ab. Man hat es also möglicher- und auch proble- matischerweise mit verschiedenen Antagonismen zu tun.

35 vgl. Ucke (1999), S. 52: Sogar Farbenblinde können diese Erscheinung wahrnehmen, denn sie beruht ausschließlich auf der Dispersion der brechenden Augenmedien.

36 vgl. ebd., S. 51: Ein Beispiel hierfür sind die wahrzunehmenden 'Waber'-Bewegungen an der Farbgrenze zwischen einem Rot- und einem Blauton derselben Helligkeit.

37 vgl. Horgan (1999), S. 343

38 Die in den Bereich der Metaphysik eingeordnete Anthroposophie sieht sich selbst durchaus als Geisteswissenschaft – vgl. Dietz (1981), S. 44 f.

39 Grundlegendes zu diesem Themenbereich stellt die Schrift »Die Farbe als philosophisches Problem« von Armin Thommes dar (siehe Quellen- und Literaturverzeichnis).

40 Nach Empedokles sind die Augen von den Göttern als erstes Werkzeug der Seele geschaffen worden und 'feuerartig' – sie senden aktiv Sehstrahlen aus, die von der Umgebung zum Auge zurückgeworfen werden.

41 Von farbigen Dingen und ihrer atomaren Zusammensetzung lösen sich stetig Bilder ab und gelangen ins Auge.

42 Pawlik (1974), S. 101, 111, 151

43 Newtons Theorien wurden allerdings nicht nur von Geisteswissenschaftlern kritisiert, sondern – aus ganz anderem Grunde – vor allem auch von Naturwissenschaftlern, die die Wellentheorie des Lichtes vertraten.

44 vgl. Kandinsky (1912), S. 59-64

45 vgl. ebd. S. 61 & 66 f.

46 Holbach, Paul Thiry de (1841): System der Natur. Leipzig, S. 35, wie zitiert in: Domschke (1982), S. 43: „Die der Materie überhaupt zukommenden Eigenschaften sind: Ausdehnung, Teilbarkeit, Undurchdringlichkeit, Bildsamkeit, Beweglichkeit ...“

47 vgl. Ostwald (1919), S. 9, aber auch: S. 36

48 ebd., S. 2

Details

Seiten
130
Jahr
2005
ISBN (eBook)
9783640193165
Dateigröße
37.2 MB
Sprache
Deutsch
Katalognummer
v117114
Institution / Hochschule
Technische Universität Berlin – Institut für Berufliche Bildung und Arbeitslehre
Note
1,0
Schlagworte
Farbe Interpretationen Wirkung Psyche Menschenbild Nutzbarmachungsversuche Architekturgestaltung Bildungs- Erziehungseinrichtungen Taut

Autor

Teilen

Zurück

Titel: Eine ganzheitliche Betrachtung des Phänomens "Farbe". Anwendung in der Architekturgestaltung von Bildungseinrichtungen am Beispiel von Bruno und Max Taut